General Information

  • ID:  hor003330
  • Uniprot ID:  P01212
  • Protein name:  Met-enkephalin-Arg-Gly-Tyr
  • Gene name:  penk-a
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMRGY
  • Length:  8(180-187)
  • Propeptide:  MGLEARHCCMFLLVFASLSVEIRADCSKDCASCALHLGQQREINSLACTLECEGKLPSAKAWGTCKELLLLTKVDNVQDGEKYQDNNDSHYAAKKYGGFMKRYGGFMKKMDELYHAEPEEDDAGGEILAKNYGGFMKKEYDSDRDAADLLRELLATSGDPESSIYHDNNSETPGEINKRYGGFMRGYRRSTDLEDETSGIQKRYGGFMRRVGRPEWWEDYQKRYGGFMTRFTDSFLPSDEDGESYSKENPDMEKR
  • Signal peptide:  MGLEARHCCMFLLVFASLSVEIRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enkephalin neuropeptides compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01212-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003330_AF2.pdbhor003330_ESM.pdb

Physical Information

Mass: 107511 Formula: C44H59N11O11S
Absent amino acids: ACDEHIKLNPQSTVW Common amino acids: G
pI: 9.17 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -45 Boman Index: -705
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: -1708.75 Extinction Coefficient cystines: 2980
Absorbance 280nm: 425.71

Literature

  • PubMed ID:  1721992
  • Title:  Characterization of Xenopus Laevis Proenkephalin Gene